Structure of PDB 7lya Chain A Binding Site BS01

Receptor Information

>7lya Chain A (length=99) Species: 9606 (Homo sapiens)

KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Ligand information

>7lya Chain I (length=147)

atcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatccgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7lya Mechanisms of BRCA1-BARD1 nucleosome recognition and ubiquitylation.
• Resolution: 2.91 Å
• Binding residue (original residue number in PDB): R42 R72 R83 F84 V117 T118
• Binding residue (residue number reindexed from 1): R6 R36 R47 F48 V81 T82

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0045296 cadherin binding

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0010467 gene expression
• GO:0032200 telomere organization
• GO:0040029 epigenetic regulation of gene expression

Cellular Component

• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7lya, PDBe:7lya, PDBj:7lya
• PDBsum: 7lya
• PubMed: 34321665
• UniProt: P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)