Structure of PDB 7lw9 Chain A Binding Site BS01

Receptor Information
>7lw9 Chain A (length=263) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLTVPVTTKEDAWA
IKFLNILLLIPTLQSEGHIREFPVFGEVEGVLLVGVIDELHYTAKGELEL
AELKTRRRPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKL
CLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEY
IHQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCR
TCTYADICEWRKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lw9 EXO5-DNA structure and BLM interactions direct DNA resection critical for ATR-dependent replication restart.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		L78 K79 Y82 V83 T84 W91 Q95 K146 G179 V180 K198 R200 Q210 K213 Y221
Binding residue
(residue number reindexed from 1)		L10 K11 Y14 V15 T16 W23 Q27 K52 G85 V86 K104 R106 Q116 K119 Y127
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004527 exonuclease activity
GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
GO:0045145 single-stranded DNA 5'-3' DNA exonuclease activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006281 DNA repair
GO:0036297 interstrand cross-link repair
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lw9, PDBe:7lw9, PDBj:7lw9
PDBsum7lw9
PubMed34197737
UniProtQ9H790|EXO5_HUMAN Exonuclease V (Gene Name=EXO5)

[Back to BioLiP]