Structure of PDB 7lw8 Chain A Binding Site BS01

Receptor Information
>7lw8 Chain A (length=260) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLVPVTTKEDAWAI
KFLNILLLIPTLQSEGHIREFPVFGEVEGVLLVGVIDELHYTAKGELELA
ELKTRRRPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLC
LEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYI
HQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRT
CTYADICEWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lw8 EXO5-DNA structure and BLM interactions direct DNA resection critical for ATR-dependent replication restart.
Resolution2.88 Å
Binding residue
(original residue number in PDB)		L78 Y80 Y82 V83 T84 W91 K146 V178 G179 V180 K198 T199 R200 R201 R202 Q210 K213 Y221 R344 T345
Binding residue
(residue number reindexed from 1)		L10 Y12 Y14 V15 T16 W23 K51 V83 G84 V85 K103 T104 R105 R106 R107 Q115 K118 Y126 R249 T250
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004527 exonuclease activity
GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
GO:0045145 single-stranded DNA 5'-3' DNA exonuclease activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006281 DNA repair
GO:0036297 interstrand cross-link repair
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lw8, PDBe:7lw8, PDBj:7lw8
PDBsum7lw8
PubMed34197737
UniProtQ9H790|EXO5_HUMAN Exonuclease V (Gene Name=EXO5)

[Back to BioLiP]