Structure of PDB 7lul Chain A Binding Site BS01

Receptor Information
>7lul Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASK
LLQPGDKIIQANGYSFINIRLEEAERLLKTFQNTVELIIVREVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lul Comprehensive Assessment of the Relationship Between Site -2 Specificity and Helix alpha 2 in the Erbin PDZ Domain.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		E32 L33 F35 S36 I37 S38 R44 G45 P47 R59 Q61 L89
Binding residue
(residue number reindexed from 1)		E14 L15 F17 S18 I19 S20 R26 G27 P29 R41 Q43 L71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7lul, PDBe:7lul, PDBj:7lul
PDBsum7lul
PubMed34171344
UniProtQ96RT1|ERBIN_HUMAN Erbin (Gene Name=ERBIN)

[Back to BioLiP]