Structure of PDB 7lkg Chain A Binding Site BS01

Receptor Information
>7lkg Chain A (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVHLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGW
IKGGNGNTRYSQKFQDRVTITRDTSASTAYMELSSLRSEDTAVYYCALLT
VITPDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEP
Ligand information
>7lkg Chain C (length=14) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDPNANPNVDPNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lkg Vaccination in a humanized mouse model elicits highly protective PfCSP-targeting anti-malarial antibodies.
Resolution2.02 Å
Binding residue
(original residue number in PDB)		A33 H35 W50 K52 R58 L95 T96 V97 I98
Binding residue
(residue number reindexed from 1)		A33 H35 W50 K52 R59 L99 T100 V101 I102
External links