Structure of PDB 7lfl Chain A Binding Site BS01

Receptor Information
>7lfl Chain A (length=275) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFHTAVSRPGRGEPQYISVGYVDDVQFQRCDSIEEIPRMEPRAP
WMEKERPEYWKELKLKVKNIAQSARANLRTLLRYYNQSEGGSHILQWMVS
CEVGPDMRLLGAHYQAAYDGSDYITLNEDLSSWTAVDMVSQITKSRLESA
GTAEYFRAYVEGECLELLHRFLRNGKEILQRADPPKAHVAHHPRPKGDVT
LRCWALGFYPADITLTWQKDEEDLTQDMELVETRPSGDGTFQKWAAVVVP
SGEEQRYTCYVHHEGLTEPLALKWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lfl Structure and dynamics of major histocompatibility class Ib molecule H2-M3 complexed with mitochondrial-derived peptides.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
Y7 H9 L63 S73 N77 Y84 W97 V99 Y114 Y123 T143 R146 L147 F156 Y159
Binding residue
(residue number reindexed from 1)
Y7 H9 L63 S73 N77 Y84 W97 V99 Y114 Y123 T143 R146 L147 F156 Y159
Enzymatic activity
Enzyme Commision number ?
External links