Structure of PDB 7lfk Chain A Binding Site BS01

Receptor Information
>7lfk Chain A (length=275) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFHTAVSRPGRGEPQYISVGYVDDVQFQRCDSIEEIPRMEPRAP
WMEKERPEYWKELKLKVKNIAQSARANLRTLLRYYNQSEGGSHILQWMVS
CEVGPDMRLLGAHYQAAYDGSDYITLNEDLSSWTAVDMVSQITKSRLESA
GTAEYFRAYVEGECLELLHRFLRNGKEILQRADPPKAHVAHHPRPKGDVT
LRCWALGFYPADITLTWQKDEEDLTQDMELVETRPSGDGTFQKWAAVVVP
SGEEQRYTCYVHHEGLTEPLALKWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lfk Structure and dynamics of major histocompatibility class Ib molecule H2-M3 complexed with mitochondrial-derived peptides.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
Y7 H9 L63 S73 A74 N77 T80 Y84 W97 V99 Y114 T143 F156 Y159
Binding residue
(residue number reindexed from 1)
Y7 H9 L63 S73 A74 N77 T80 Y84 W97 V99 Y114 T143 F156 Y159
Enzymatic activity
Enzyme Commision number ?
External links