Structure of PDB 7lfc Chain A Binding Site BS01

Receptor Information
>7lfc Chain A (length=414) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVH
CLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQ
NVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVT
WVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTD
AGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQV
VLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVP
MIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLT
VKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENE
DIYKLAYEIIDQFF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lfc Differential recognition of canonical NF-kappa B dimers by Importin alpha 3.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
K97 S100 D102 R103 P105 W137 N141 S144 G145 T150 Q176 W179 N183 G186 D187 N219 W222 N226 R229 R306
Binding residue
(residue number reindexed from 1)
K26 S29 D31 R32 P34 W66 N70 S73 G74 T79 Q105 W108 N112 G115 D116 N148 W151 N155 R158 R235
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008139 nuclear localization sequence binding
GO:0061608 nuclear import signal receptor activity
Biological Process
GO:0006606 protein import into nucleus
GO:0006607 NLS-bearing protein import into nucleus
GO:0010467 gene expression
GO:0014046 dopamine secretion
GO:0015031 protein transport
Cellular Component
GO:0005634 nucleus
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031965 nuclear membrane
GO:0042564 NLS-dependent protein nuclear import complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7lfc, PDBe:7lfc, PDBj:7lfc
PDBsum7lfc
PubMed35260573
UniProtO00629|IMA3_HUMAN Importin subunit alpha-3 (Gene Name=KPNA4)

[Back to BioLiP]