Structure of PDB 7lbw Chain A Binding Site BS01

Receptor Information
>7lbw Chain A (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lbw A minimal motif for sequence recognition by mitochondrial transcription factor A (TFAM).
Resolution2.84 Å
Binding residue
(original residue number in PDB)
R157 Y162 Q179 L182 K183 K186 Y211 R232 R233 T234 K236
Binding residue
(residue number reindexed from 1)
R114 Y119 Q136 L139 K140 K143 Y168 R189 R190 T191 K193
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7lbw, PDBe:7lbw, PDBj:7lbw
PDBsum7lbw
PubMed34928349
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]