Structure of PDB 7l4z Chain A Binding Site BS01

Receptor Information
>7l4z Chain A (length=199) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPD
DFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGS
TPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG
Ligand information
>7l4z Chain R (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YKAGVVYGYNAWIRC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7l4z Discovery of Cyclic Peptide Ligands to the SARS-CoV-2 Spike Protein Using mRNA Display.
Resolution3.96 Å
Binding residue
(original residue number in PDB)		P330 N331 I332 N360 C361 V362 A363 N388 D389 L390 C391 F392 V524
Binding residue
(residue number reindexed from 1)		P3 N4 I5 N33 C34 V35 A36 N61 D62 L63 C64 F65 V197
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7l4z, PDBe:7l4z, PDBj:7l4z
PDBsum7l4z
PubMed34230894
UniProtP0DTC2|SPIKE_SARS2 Spike glycoprotein (Gene Name=S)

[Back to BioLiP]