Structure of PDB 7l4v Chain A Binding Site BS01

Receptor Information
>7l4v Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKV
EQLSRELSTLRNLFKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7l4v Preferential CEBP binding to T:G mismatches and increased C-to-T human somatic mutations.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		R277 R280 A284 V285 K287 S288
Binding residue
(residue number reindexed from 1)		R10 R13 A17 V18 K20 S21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7l4v, PDBe:7l4v, PDBj:7l4v
PDBsum7l4v
PubMed33877329
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]