Structure of PDB 7l3b Chain A Binding Site BS01

Receptor Information

>7l3b Chain A (length=162) Species: 10665 (Tequatrovirus T4)

MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAI
GRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCAAI
NMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVI
TTFRTGTWDAYK

Ligand information

• Ligand ID: PIH
• InChI: InChI=1S/C6H5I/c7-6-4-2-1-3-5-6/h1-5H
• InChIKey: SNHMUERNLJLMHN-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341: Ic1ccccc1
  OpenEye OEToolkits 1.5.0: c1ccc(cc1)I
• Formula: C6 H5 I
• Name: iodobenzene
• ChEMBL: CHEMBL116296
• DrugBank: DB02252
• ZINC: ZINC000001699878
• PDB chain: 7l3b Chain A Residue 205

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7l3b Temperature artifacts in protein structures bias ligand-binding predictions.
• Resolution: 1.27 Å
• Binding residue (original residue number in PDB): L84 Y88 A99 L118
• Binding residue (residue number reindexed from 1): L84 Y88 A99 L118
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.2.1.17: lysozyme.

Gene Ontology

Molecular Function

• GO:0003796 lysozyme activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds

Biological Process

• GO:0009253 peptidoglycan catabolic process
• GO:0016998 cell wall macromolecule catabolic process
• GO:0031640 killing of cells of another organism
• GO:0042742 defense response to bacterium
• GO:0044659 viral release from host cell by cytolysis

Cellular Component

• GO:0030430 host cell cytoplasm

External links

• PDB: RCSB:7l3b, PDBe:7l3b, PDBj:7l3b
• PDBsum: 7l3b
• PubMed: 34667539
• UniProt: P00720|ENLYS_BPT4 Endolysin (Gene Name=E)