Structure of PDB 7l1k Chain A Binding Site BS01

Receptor Information
>7l1k Chain A (length=149) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVTIVPYSHQYLKDICQLIQKDLSEPYSKYVYRYFVHQWPEFSFVALDND
RFIGAVICKQDVHRGTTLRGYIAMLAIVKEYRGQGIATKLTQASLDVMKN
RGAQEIVLETEVDNEAAMSFYERLGFCRYKRLYRYYLNGTDAFRYILYP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7l1k Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
Resolution3.16 Å
Binding residue
(original residue number in PDB)		E25 Y27 F35 A73 E109 Y135 Y136
Binding residue
(residue number reindexed from 1)		E25 Y27 F35 A73 E109 Y135 Y136
Enzymatic activity
Enzyme Commision number 2.3.1.256: N-terminal methionine N(alpha)-acetyltransferase NatC.
Gene Ontology
Molecular Function
GO:0000822 inositol hexakisphosphate binding
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0120518 peptide-methionine-alpha-N-acetyltransferase activity
Biological Process
GO:0017196 N-terminal peptidyl-methionine acetylation
GO:0051604 protein maturation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031417 NatC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7l1k, PDBe:7l1k, PDBj:7l1k
PDBsum7l1k
PubMed34019809
UniProtO74311|NAA30_SCHPO N-alpha-acetyltransferase 30 (Gene Name=naa30)

[Back to BioLiP]