Structure of PDB 7kzg Chain A Binding Site BS01

Receptor Information
>7kzg Chain A (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYP
SAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHG
IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kzg Structural Insights into the Mechanism of Base Excision by MBD4.
Resolution1.68 Å
Binding residue
(original residue number in PDB)		L466 N467 R468 T469 S470 G471 H535 G536 I537 G538 Y540 D560
Binding residue
(residue number reindexed from 1)		L30 N31 R32 T33 S34 G35 H99 G100 I101 G102 Y104 D124
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kzg, PDBe:7kzg, PDBj:7kzg
PDBsum7kzg
PubMed34107280
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]