Structure of PDB 7kz1 Chain A Binding Site BS01

Receptor Information
>7kz1 Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKY
PSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELH
GIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kz1 Structural Insights into the Mechanism of Base Excision by MBD4.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		L466 N467 R468 H535 G536 G538 Y540 D560 K562
Binding residue
(residue number reindexed from 1)		L31 N32 R33 H100 G101 G103 Y105 D125 K127
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kz1, PDBe:7kz1, PDBj:7kz1
PDBsum7kz1
PubMed34107280
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]