Structure of PDB 7kuf Chain A Binding Site BS01

Receptor Information
>7kuf Chain A (length=73) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRAEPWGV
WGGEIFDQGSIVSHKRPRGRPRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kuf Structural insights into the functional divergence of WhiB-like proteins in Mycobacterium tuberculosis.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R81 P82 R83 R85 P86
Binding residue
(residue number reindexed from 1)		R66 P67 R68 R70 P71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0035731 dinitrosyl-iron complex binding
GO:0046872 metal ion binding
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045454 cell redox homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:0070542 response to fatty acid
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kuf, PDBe:7kuf, PDBj:7kuf
PDBsum7kuf
PubMed34171298
UniProtQ6MX01|WHB7A_MYCTU Probable transcriptional regulator WhiB7 (Gene Name=whiB7)

[Back to BioLiP]