Structure of PDB 7kpk Chain A Binding Site BS01

Receptor Information
>7kpk Chain A (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGKVVKFSYMWTINNFSFGEVIKSSTFSSGANDKLKWCLRVNPKGLDEES
KDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESRAYRFVQGKDW
GFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kpk Intrinsically disordered substrates dictate SPOP subnuclear localization and ubiquitination activity.
Resolution1.71 Å
Binding residue
(original residue number in PDB)		L76 Y87 F102 Y123 K129 D130 W131 G132 F133
Binding residue
(residue number reindexed from 1)		L46 Y57 F72 Y92 K98 D99 W100 G101 F102
Enzymatic activity
Enzyme Commision number ?
External links