Structure of PDB 7kl2 Chain A Binding Site BS01

Receptor Information
>7kl2 Chain A (length=268) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQK
LEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREY
YSEADASHCIQQILEAVLHCHQMGVVHRNLKPENLLLASKLKGAAVKLAD
FGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYIL
LVGYPPFWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP
SKRITAAEALKHPWISHR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kl2 Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
Resolution2.56 Å
Binding residue
(original residue number in PDB)		R52 F98 N135 K137 E139 L159 F173 A174 G175 T176 G178 Y210 P211 W214 Q218 H219 E236
Binding residue
(residue number reindexed from 1)		R46 F92 N129 K131 E133 L153 F167 A168 G169 T170 G172 Y204 P205 W208 Q212 H213 E230
Enzymatic activity
Catalytic site (original residue number in PDB) N135 K137 N140 D156 T176
Catalytic site (residue number reindexed from 1) N129 K131 N134 D150 T170
Enzyme Commision number 2.7.11.17: calcium/calmodulin-dependent protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kl2, PDBe:7kl2, PDBj:7kl2
PDBsum7kl2
PubMed
UniProtQ9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha (Gene Name=CAMK2A)

[Back to BioLiP]