Structure of PDB 7kl1 Chain A Binding Site BS01

Receptor Information
>7kl1 Chain A (length=268) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQK
LEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREY
YSEADASHCIQQILEAVLHCHQMGVVHRNLKPENLLLASKLKGAAVKLAD
FGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYIL
LVGYPPFWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP
SKRITAAEALKHPWISHR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kl1 CaMKII binds both substrates and activators at the active site.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		E96 F98 E99 N135 E139 F173 A174 G175 T176 P177 Y210 P211 P212 W214 Q218
Binding residue
(residue number reindexed from 1)		E90 F92 E93 N129 E133 F167 A168 G169 T170 P171 Y204 P205 P206 W208 Q212
Enzymatic activity
Catalytic site (original residue number in PDB) N135 K137 N140 D156 T176
Catalytic site (residue number reindexed from 1) N129 K131 N134 D150 T170
Enzyme Commision number 2.7.11.17: calcium/calmodulin-dependent protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kl1, PDBe:7kl1, PDBj:7kl1
PDBsum7kl1
PubMed35830796
UniProtQ9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha (Gene Name=CAMK2A)

[Back to BioLiP]