Structure of PDB 7kik Chain A Binding Site BS01

Receptor Information
>7kik Chain A (length=121) Species: 10834 (Wheat dwarf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPFSIFHPNIQAAKDCNQVRDFITKEVDSDVNTAEWGTFVAVSTRFRVYS
KYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELHEDGSPHLHVL
VQNKLRASITNPNALNLRMDT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kik Wheat dwarf virus Rep domain circular permutation complexed with a single-stranded DNA 10-mer comprising the cleavage site and Mn2+
Resolution1.73 Å
Binding residue
(original residue number in PDB)		H7 N9 I10 Q11 A13 K14 V19 F22 F62 R63 F70 T72 P74 Q75 H106 E107 H114 P128
Binding residue
(residue number reindexed from 1)		H7 N9 I10 Q11 A13 K14 V19 F22 F46 R47 F54 T56 P58 Q59 H90 E91 H98 P112
Enzymatic activity
Enzyme Commision number 2.7.7.-
3.1.21.-
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kik, PDBe:7kik, PDBj:7kik
PDBsum7kik
PubMed36541758
UniProtQ67622|REP_WDVS Replication-associated protein (Gene Name=C1/C2)

[Back to BioLiP]