Structure of PDB 7kgr Chain A Binding Site BS01

Receptor Information
>7kgr Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVP
SGQEQRYTCHVQHEGLPKPLTLRW
Ligand information
>7kgr Chain C (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LQLPQGTTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kgr The presentation of SARS-CoV-2 peptides by the common HLA-A * 02:01 molecule.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		Y7 M45 E63 K66 V67 T73 V76 D77 L81 Y99 Y116 Y123 T143 K146 W147 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 M45 E63 K66 V67 T73 V76 D77 L81 Y99 Y116 Y123 T143 K146 W147 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links