Structure of PDB 7kgp Chain A Binding Site BS01

Receptor Information
>7kgp Chain A (length=278) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVP
SGQEQRYTCHVQHEGLPKPLTLRWEPSS
Ligand information
>7kgp Chain C (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GMSRIGMEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kgp The presentation of SARS-CoV-2 peptides by the common HLA-A * 02:01 molecule.
Resolution1.396 Å
Binding residue
(original residue number in PDB)		M5 Y7 F9 E63 K66 V67 H70 V76 D77 Y84 Y99 Y116 T143 K146 W147 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		M5 Y7 F9 E63 K66 V67 H70 V76 D77 Y84 Y99 Y116 T143 K146 W147 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links