Structure of PDB 7kfa Chain A Binding Site BS01

Receptor Information
>7kfa Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTK
ILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kfa Identification of a PCSK9-LDLR disruptor peptide with in vivo function.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
W72 F150 A151 Q152
Binding residue
(residue number reindexed from 1)
W12 F90 A91 Q92
Enzymatic activity
Enzyme Commision number 3.4.21.-
External links
PDB RCSB:7kfa, PDBe:7kfa, PDBj:7kfa
PDBsum7kfa
PubMed34547225
UniProtQ8NBP7|PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 (Gene Name=PCSK9)

[Back to BioLiP]