Structure of PDB 7kbf Chain A Binding Site BS01

Receptor Information
>7kbf Chain A (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>7kbf Chain I (length=172) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttggccagctaggatatcacaatcccggtgccgaggccgctcaattggtc
gtagacagctctagcaccgcttaaacgcacgtacggaatccgtacgtgcg
tttaagcggtgctagagctgtctacgaccaattgagcggcctcggcaccg
ggattgtgatatcctagctggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kbf Structural features of nucleosomes in interphase and metaphase chromosomes.
Resolution4.42 Å
Binding residue
(original residue number in PDB)
R40 Y41 R42 P43 T45 R72 R83 F84 Q85 R116 V117 T118
Binding residue
(residue number reindexed from 1)
R4 Y5 R6 P7 T9 R36 R47 F48 Q49 R80 V81 T82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7kbf, PDBe:7kbf, PDBj:7kbf
PDBsum7kbf
PubMed34478647
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]