Structure of PDB 7k80 Chain A Binding Site BS01

Receptor Information
>7k80 Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k80 The Role of the HLA Class I alpha 2 Helix in Determining Ligand Hierarchy for the Killer Cell Ig-like Receptor 3DL1.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
Y7 E63 V67 H70 T73 N77 Y84 L95 F99 Y116 Y123 T143 K146 W147 V152 Q155 Q156 Y159 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 V67 H70 T73 N77 Y84 L95 F99 Y116 Y123 T143 K146 W147 V152 Q155 Q156 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
External links