Structure of PDB 7k7f Chain A Binding Site BS01

Receptor Information
>7k7f Chain A (length=143) Species: 257309 (Corynebacterium diphtheriae NCTC 13129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERTSIAVHALMGLPTGQPANGTKLDSIGLPKVDGMSFTLYRVNEIDLTTQ
AGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVV
QELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALS
Ligand information
>7k7f Chain B (length=10) Species: 1717 (Corynebacterium diphtheriae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KNAGFELPLT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k7f Sortase-assembled pili in Corynebacterium diphtheriae are built using a latch mechanism.
ResolutionN/A
Binding residue
(original residue number in PDB)		A71 A108 L113 L148 L168 Y188 K190
Binding residue
(residue number reindexed from 1)		A19 A56 L61 L96 L116 Y136 K138
Enzymatic activity
Enzyme Commision number ?
External links