Structure of PDB 7k5l Chain A Binding Site BS01

Receptor Information
>7k5l Chain A (length=124) Species: 128952 (Ebola virus - Mayinga, Zaire, 1976) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLA
SYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQL
PQYFTFDLTALKLITQPLPAATWT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k5l Cellular mRNA triggers structural transformation of Ebola virus matrix protein VP40 to its essential regulatory form.
Resolution1.38 Å
Binding residue
(original residue number in PDB)
F125 G126 K127 R134 Y171
Binding residue
(residue number reindexed from 1)
F57 G58 K59 R66 Y103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7k5l, PDBe:7k5l, PDBj:7k5l
PDBsum7k5l
PubMed33852858
UniProtQ05128|VP40_EBOZM Matrix protein VP40 (Gene Name=VP40)

[Back to BioLiP]