Structure of PDB 7k5d Chain A Binding Site BS01

Receptor Information
>7k5d Chain A (length=123) Species: 128952 (Ebola virus - Mayinga, Zaire, 1976) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLA
SYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQL
PQYFTFDLTALKLITQPLPAATW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k5d Cellular mRNA triggers structural transformation of Ebola virus matrix protein VP40 to its essential regulatory form.
Resolution1.78 Å
Binding residue
(original residue number in PDB)
F125 G126 R134
Binding residue
(residue number reindexed from 1)
F57 G58 R66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7k5d, PDBe:7k5d, PDBj:7k5d
PDBsum7k5d
PubMed33852858
UniProtQ05128|VP40_EBOZM Matrix protein VP40 (Gene Name=VP40)

[Back to BioLiP]