Structure of PDB 7k2l Chain A Binding Site BS01

Receptor Information

>7k2l Chain A (length=284) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLY
AVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHI
YAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAV
GGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGY
DGQDQLNSVERYDVATATWTFVAPMKHRRSALGITVHQGRIYVLGGYDGH
TFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT

Ligand information

>7k2l Chain P (length=7) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ANPETGE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7k2l Recapitulating the Binding Affinity of Nrf2 for KEAP1 in a Cyclic Heptapeptide, Guided by NMR, X-ray Crystallography, and Machine Learning.
Resolution	1.98 Å
Binding residue (original residue number in PDB)	Y334 S363 R380 N382 R415 R483 S508 G509 Y525 Q530 S555 Y572 F577 S602
Binding residue (residue number reindexed from 1)	Y9 S38 R55 N57 R90 R158 S183 G184 Y200 Q205 S230 Y247 F252 S277

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:7k2l, PDBe:7k2l, PDBj:7k2l
PDBsum	7k2l
PubMed	33683866
UniProt	Q14145\|KEAP1_HUMAN Kelch-like ECH-associated protein 1 (Gene Name=KEAP1)

[Back to BioLiP]