Structure of PDB 7jyv Chain A Binding Site BS01

Receptor Information
>7jyv Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jyv CD8 + T cell landscape in Indigenous and non-Indigenous people restricted by influenza mortality-associated HLA-A*24:02 allomorph.
Resolution1.51 Å
Binding residue
(original residue number in PDB)		Y7 Y59 E63 K66 A69 T73 N77 I80 Y84 L95 F99 Y116 Y123 T143 K146 W147 Q155 Q156 Y159 T163 G167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y59 E63 K66 A69 T73 N77 I80 Y84 L95 F99 Y116 Y123 T143 K146 W147 Q155 Q156 Y159 T163 G167 Y171
Enzymatic activity
Enzyme Commision number ?
External links