Structure of PDB 7jx7 Chain A Binding Site BS01

Receptor Information
>7jx7 Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPM
DLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQD
VFEFRYAKMPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jx7 The bromodomains of BET family proteins can recognize diacetylated histone H2A.Z.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
W370 Y428 N429 P430 H433 V435
Binding residue
(residue number reindexed from 1)
W26 Y84 N85 P86 H89 V91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7jx7, PDBe:7jx7, PDBj:7jx7
PDBsum7jx7
PubMed33247496
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]