Structure of PDB 7jwi Chain A Binding Site BS01

Receptor Information
>7jwi Chain A (length=277) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVT
LRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVP
LGKEQNYTCRVYHEGLPEPLTLRWEPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jwi Canonical T cell receptor docking on peptide-MHC is essential for T cell signaling.
Resolution3.02 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 Q70 W73 S77 N80 Y84 L95 Q97 Y123 T143 K146 W147 S150 H155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 Q70 W73 S77 N80 Y84 L95 Q97 Y123 T143 K146 W147 S150 H155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation

View graph for
Biological Process
External links
PDB RCSB:7jwi, PDBe:7jwi, PDBj:7jwi
PDBsum7jwi
PubMed34083463
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]