Structure of PDB 7jq8 Chain A Binding Site BS01

Receptor Information
>7jq8 Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHHHSHMGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGR
VVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKK
Ligand information
>7jq8 Chain B (length=23) Species: 928306 (Moloney murine leukemia virus isolate Shinnick) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SRLTWRVQRSQNPLKIRLTREAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jq8 A common binding motif in the ET domain of BRD3 forms polymorphic structural interfaces with host and viral proteins.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y30 R34 S37 N41 L48 V52 D68 E69 I70 E71 I72 D73 F74 E75
Binding residue
(residue number reindexed from 1)		Y30 R34 S37 N41 L48 V52 D68 E69 I70 E71 I72 D73 F74 E75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7jq8, PDBe:7jq8, PDBj:7jq8
PDBsum7jq8
PubMed33592170
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]