Structure of PDB 7gat Chain A Binding Site BS01

Receptor Information

>7gat Chain A (length=66) Species: 162425 (Aspergillus nidulans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKNGEQNGPTTCTNCFTQTTPVWRRNPEGQPLCNACGLFLKLHGVVRPLS
LKTDVIKKRNRNSANS

Ligand information

>7gat Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtctctatcactg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7gat The solution structure of the Leu22-->Val mutant AREA DNA binding domain complexed with a TGATAG core element defines a role for hydrophobic packing in the determination of specificity.
Resolution	N/A
Binding residue (original residue number in PDB)	P21 N34 F39 H43 R47 R61 N62 S63
Binding residue (residue number reindexed from 1)	P21 N34 F39 H43 R47 R61 N62 S63
Binding affinity	PDBbind-CN: Kd=3.1uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7gat, PDBe:7gat, PDBj:7gat
PDBsum	7gat
PubMed	9533884
UniProt	P17429\|AREA_EMENI Nitrogen regulatory protein areA (Gene Name=areA)

[Back to BioLiP]