Structure of PDB 7g1b Chain A Binding Site BS01

Receptor Information
>7g1b Chain A (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDV
ITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWD
GKSTTIKRKREDDKLVVECVMKGVTSTRVYERA
Ligand information
Ligand IDWNB
InChIInChI=1S/C19H16ClNO2/c20-14-6-3-4-12(8-14)11-21-17-7-2-1-5-13(17)9-18(21)15-10-16(15)19(22)23/h1-9,15-16H,10-11H2,(H,22,23)/t15-,16-/m0/s1
InChIKeyRGBCHGAFMRTILT-HOTGVXAUSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 2.0.7c1ccc2c(c1)cc(n2Cc3cccc(c3)Cl)C4CC4C(=O)O
CACTVS 3.385OC(=O)[C@H]1C[C@@H]1c2cc3ccccc3n2Cc4cccc(Cl)c4
OpenEye OEToolkits 2.0.7c1ccc2c(c1)cc(n2Cc3cccc(c3)Cl)[C@H]4C[C@@H]4C(=O)O
CACTVS 3.385OC(=O)[CH]1C[CH]1c2cc3ccccc3n2Cc4cccc(Cl)c4
ACDLabs 12.01O=C(O)C1CC1c1cc2ccccc2n1Cc1cccc(Cl)c1
FormulaC19 H16 Cl N O2
Name(1S,2S)-2-{1-[(3-chlorophenyl)methyl]-1H-indol-2-yl}cyclopropane-1-carboxylic acid
ChEMBL
DrugBank
ZINC
PDB chain7g1b Chain A Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7g1b Crystal Structure of a human FABP4 complex
Resolution1.17 Å
Binding residue
(original residue number in PDB)		F17 M21 A76 D77 R127 Y129
Binding residue
(residue number reindexed from 1)		F18 M22 A77 D78 R128 Y130
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005324 long-chain fatty acid transmembrane transporter activity
GO:0005504 fatty acid binding
GO:0008289 lipid binding
GO:0036041 long-chain fatty acid binding
GO:0051427 hormone receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0015908 fatty acid transport
GO:0015909 long-chain fatty acid transport
GO:0042632 cholesterol homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0050729 positive regulation of inflammatory response
GO:0050872 white fat cell differentiation
GO:0050873 brown fat cell differentiation
GO:0071285 cellular response to lithium ion
GO:0071356 cellular response to tumor necrosis factor
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7g1b, PDBe:7g1b, PDBj:7g1b
PDBsum7g1b
PubMed
UniProtP15090|FABP4_HUMAN Fatty acid-binding protein, adipocyte (Gene Name=FABP4)

[Back to BioLiP]