Structure of PDB 7fz6 Chain A Binding Site BS01

Receptor Information
>7fz6 Chain A (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGD
VITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKW
DGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA
Ligand information
Ligand IDWEA
InChIInChI=1S/C14H18O3/c15-14(16)13-9-5-4-6-11(13)10-17-12-7-2-1-3-8-12/h1-3,7-8,11,13H,4-6,9-10H2,(H,15,16)/t11-,13-/m0/s1
InChIKeyHHDLMNMQVNXMOO-AAEUAGOBSA-N
SMILES
SoftwareSMILES
ACDLabs 12.01O=C(O)C1CCCCC1COc1ccccc1
OpenEye OEToolkits 2.0.7c1ccc(cc1)OC[C@@H]2CCCC[C@@H]2C(=O)O
CACTVS 3.385OC(=O)[CH]1CCCC[CH]1COc2ccccc2
OpenEye OEToolkits 2.0.7c1ccc(cc1)OCC2CCCCC2C(=O)O
CACTVS 3.385OC(=O)[C@H]1CCCC[C@H]1COc2ccccc2
FormulaC14 H18 O3
Name(1S,2R)-2-(phenoxymethyl)cyclohexane-1-carboxylic acid
ChEMBL
DrugBank
ZINC
PDB chain7fz6 Chain A Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fz6 Crystal Structure of a human FABP4 complex
Resolution1.09 Å
Binding residue
(original residue number in PDB)		F16 R126 Y128
Binding residue
(residue number reindexed from 1)		F19 R129 Y131
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005324 long-chain fatty acid transmembrane transporter activity
GO:0005504 fatty acid binding
GO:0008289 lipid binding
GO:0036041 long-chain fatty acid binding
GO:0051427 hormone receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0015908 fatty acid transport
GO:0015909 long-chain fatty acid transport
GO:0042632 cholesterol homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0050729 positive regulation of inflammatory response
GO:0050872 white fat cell differentiation
GO:0050873 brown fat cell differentiation
GO:0071285 cellular response to lithium ion
GO:0071356 cellular response to tumor necrosis factor
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fz6, PDBe:7fz6, PDBj:7fz6
PDBsum7fz6
PubMed
UniProtP15090|FABP4_HUMAN Fatty acid-binding protein, adipocyte (Gene Name=FABP4)

[Back to BioLiP]