Structure of PDB 7fdm Chain A Binding Site BS01

Receptor Information
>7fdm Chain A (length=170) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSGDNTVILGWGDGYY
KGEAEQEHRKRVIRELNSLISGDEEVTDTEWFFLVSMTQSFVNGVGLPGE
SFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSS
EVISQSSDLMHKVNNLFNFN
Ligand information
>7fdm Chain C (length=20) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSTSKLLNKVAARASSMGTI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fdm Structural insights into partner selection for MYB and bHLH transcription factor complexes.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		W92 G93 D94 Y96 Y97 R123 E142 E148 L152 M155
Binding residue
(residue number reindexed from 1)		W45 G46 D47 Y49 Y50 R64 E74 E80 L84 M87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7fdm, PDBe:7fdm, PDBj:7fdm
PDBsum7fdm
PubMed35995835
UniProtQ9FIP9|MYC3_ARATH Transcription factor MYC3 (Gene Name=MYC3)

[Back to BioLiP]