Structure of PDB 7fax Chain A Binding Site BS01

Receptor Information
>7fax Chain A (length=103) Species: 185431 (Trypanosoma brucei brucei TREU927) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVTNATLETTGKELTETYMEMLNGDVVEVSIANEERIVSLLSSLASANVT
LKQLIGTKIGVAVGQFLSDGFPPHIVRFSKGILDYWFRQLPEEVQKQLLA
KRA
Ligand information
>7fax Chain B (length=14) Species: 185431 (Trypanosoma brucei brucei TREU927) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSTLEDLFGPLFYV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fax Complex structure of TbLeo1 and LW domain from Trypanosoma brucei
Resolution1.8 Å
Binding residue
(original residue number in PDB)
G66 V67 L73 S74 K86 L89 F93 L104 L105 R108
Binding residue
(residue number reindexed from 1)
G60 V61 L67 S68 K80 L83 F87 L98 L99 R102
Enzymatic activity
Enzyme Commision number ?
External links