Structure of PDB 7f87 Chain A Binding Site BS01

Receptor Information
>7f87 Chain A (length=145) Species: 47715 (Lacticaseibacillus rhamnosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLHPIGKIAITSVHLKLPILKGLSNDNLSAGAGTMKADQKMGEGNYALAG
HYMTNQGILFSPLKNVQTGDTVAITNMKKVYTYKVTTKQIVNETQVQWID
DVAGKKLITLVTCASPTEGEVDRIIVQGELQSVKKANQKNLKIFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f87 Crystal structure of housekeeping sortase SrtA bound with self derived tripeptide from Lactobacillus rhamnosus GG
Resolution1.69 Å
Binding residue
(original residue number in PDB)
E181 V184
Binding residue
(residue number reindexed from 1)
E93 V96
Enzymatic activity
Enzyme Commision number ?
External links