Structure of PDB 7f7i Chain A Binding Site BS01

Receptor Information
>7f7i Chain A (length=182) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYH
FVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVS
ANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLE
QEFTECFSAIVEGDSFEEIYHKVKRVIEDLSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f7i Entropy of stapled peptide inhibitors in free state is the major contributor to the improvement of binding affinity with the GK domain.
Resolution2.595 Å
Binding residue
(original residue number in PDB)
D545 P564 R568 E574 Y580 E600 G602 Y604 Y609 G610 T611 D629
Binding residue
(residue number reindexed from 1)
D14 P33 R37 E43 Y49 E69 G71 Y73 Y78 G79 T80 D98
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7f7i, PDBe:7f7i, PDBj:7f7i
PDBsum7f7i
PubMed34458841
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]