Structure of PDB 7f7g Chain A Binding Site BS01

Receptor Information
>7f7g Chain A (length=186) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEFVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDG
RDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCI
LDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRA
TKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f7g Entropy of stapled peptide inhibitors in free state is the major contributor to the improvement of binding affinity with the GK domain.
Resolution2.446 Å
Binding residue
(original residue number in PDB)
D545 V563 P564 R568 R571 D579 Y580 E600 Q603 Y604 Y609 G610 T611 D629
Binding residue
(residue number reindexed from 1)
D18 V36 P37 R41 R44 D52 Y53 E73 Q76 Y77 Y82 G83 T84 D102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7f7g, PDBe:7f7g, PDBj:7f7g
PDBsum7f7g
PubMed34458841
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]