Structure of PDB 7f6h Chain A Binding Site BS01

Receptor Information
>7f6h Chain A (length=305) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CPQVEWLGWLNTIQPPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYL
GNLAAADLILACGLPFWAITISNNFDWLFGETLCRVVNAIISMNLYSSIC
FLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFR
TMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVITFCTMQ
IMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLH
RLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEV
YQGVC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f6h Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		W113 F121 L141 R196 Y201 V212 I213 L228 F286 R297 D311 T314 S318 Y322
Binding residue
(residue number reindexed from 1)		W67 F75 L95 R150 Y155 V166 I167 L182 F240 R251 D265 T268 S272 Y276
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0004435 phosphatidylinositol phospholipase C activity
GO:0004930 G protein-coupled receptor activity
GO:0004947 bradykinin receptor activity
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:0031702 type 1 angiotensin receptor binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006939 smooth muscle contraction
GO:0006954 inflammatory response
GO:0007166 cell surface receptor signaling pathway
GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0008015 blood circulation
GO:0008643 carbohydrate transport
GO:0009651 response to salt stress
GO:0019229 regulation of vasoconstriction
GO:0042311 vasodilation
GO:0043114 regulation of vascular permeability
GO:0050482 arachidonate secretion
GO:0055085 transmembrane transport
GO:1902219 negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress
GO:1902239 negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator
GO:1990127 intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator
Cellular Component
GO:0005768 endosome
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f6h, PDBe:7f6h, PDBj:7f6h
PDBsum7f6h
PubMed35132089
UniProtP30411|BKRB2_HUMAN B2 bradykinin receptor (Gene Name=BDKRB2)

[Back to BioLiP]