Structure of PDB 7f5m Chain A Binding Site BS01

Receptor Information
>7f5m Chain A (length=139) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDHSIEVTFRVKTQQVIIPEQNIRGNELPLRRWQMELLMLDATGKEVEPT
ILSKCIYHLHSSFKQPKRRLNSLPFFIKETGWGEFNLKIECFFIGNAGKF
SIEHDLTFEDDAYAVDYTVDVPHEFSHLNSELSKYFDLP
Ligand information
>7f5m Chain C (length=20) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KQLASKAARGSAPSTGGVKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f5m Global profiling of regulatory elements in the histone benzoylation pathway.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		I23 G25 N26 E27 L28 P29 H60 S62 F63 G81 W82 G83 E84 N86 E103 D111
Binding residue
(residue number reindexed from 1)		I23 G25 N26 E27 L28 P29 H60 S62 F63 G81 W82 G83 E84 N86 E103 D111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7f5m, PDBe:7f5m, PDBj:7f5m
PDBsum7f5m
PubMed35296687
UniProtQ99314|SAS5_YEAST Something about silencing protein 5 (Gene Name=SAS5)

[Back to BioLiP]