Structure of PDB 7f4a Chain A Binding Site BS01

Receptor Information
>7f4a Chain A (length=136) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIF
DKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKI
PHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST
Ligand information
>7f4a Chain B (length=5) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QTARK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f4a Global profiling of regulatory elements in the histone benzoylation pathway.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		F27 H59 T61 F62 G80 W81 G82 G83 F84 D104 F107 L108
Binding residue
(residue number reindexed from 1)		F26 H58 T60 F61 G79 W80 G81 G82 F83 D103 F106 L107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7f4a, PDBe:7f4a, PDBj:7f4a
PDBsum7f4a
PubMed35296687
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]