Structure of PDB 7f49 Chain A Binding Site BS01

Receptor Information
>7f49 Chain A (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVA
VVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQ
IFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIG
PHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAP
Ligand information
>7f49 Chain B (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccagggaccuaagacacaugucccuggct
<<<<<<<<<...........>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f49 The development and characterization of a long acting anti-thrombotic von Willebrand factor (VWF) aptamer
Resolution2.09 Å
Binding residue
(original residue number in PDB)		K599 F603 S607 Q628 R629 R632 N633 V635 R636 Y637 Q639 G640 K643 K644
Binding residue
(residue number reindexed from 1)		K95 F99 S103 Q124 R125 R128 N129 V131 R132 Y133 Q135 G136 K139 K140
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7f49, PDBe:7f49, PDBj:7f49
PDBsum7f49
PubMed32011054
UniProtP04275|VWF_HUMAN von Willebrand factor (Gene Name=VWF)

[Back to BioLiP]