Structure of PDB 7f3s Chain A Binding Site BS01

Receptor Information
>7f3s Chain A (length=110) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPM
AIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNE
FTDEWFKEHS
Ligand information
>7f3s Chain B (length=18) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TARKSTGGGAPRKQLASY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f3s Global profiling of regulatory elements in the histone benzoylation pathway.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		D1267 D1270 H1272 S1276 I1277 F1278 Y1287 V1293 F1331 Y1332 N1333 E1334 W1338
Binding residue
(residue number reindexed from 1)		D19 D22 H24 S28 I29 F30 Y39 V45 F83 Y84 N85 E86 W90
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Biological Process
GO:0006338 chromatin remodeling
Cellular Component
GO:0016586 RSC-type complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f3s, PDBe:7f3s, PDBj:7f3s
PDBsum7f3s
PubMed35296687
UniProtP32597|STH1_YEAST Nuclear protein STH1/NPS1 (Gene Name=STH1)

[Back to BioLiP]