Structure of PDB 7f3l Chain A Binding Site BS01

Receptor Information
>7f3l Chain A (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNKFLRSVG
DGETVEFDVVEGEKGAEATNVTGPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f3l Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P62
Resolution1.88 Å
Binding residue
(original residue number in PDB)		K99 W100 N102 Y107 F109 D118 F120 H122 K153 G154
Binding residue
(residue number reindexed from 1)		K13 W14 N16 Y21 F23 D32 F34 H36 K64 G65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7f3l, PDBe:7f3l, PDBj:7f3l
PDBsum7f3l
PubMed
UniProtQ9Y2T7|YBOX2_HUMAN Y-box-binding protein 2 (Gene Name=YBX2)

[Back to BioLiP]