Structure of PDB 7f3k Chain A Binding Site BS01

Receptor Information
>7f3k Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRS
VGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f3k Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P21212
Resolution1.76 Å
Binding residue
(original residue number in PDB)		K99 W100 N102 V103 R104 N105 Y107 F109 D118 F120 K153 R172 Y173
Binding residue
(residue number reindexed from 1)		K12 W13 N15 V16 R17 N18 Y20 F22 D31 F33 K66 R85 Y86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7f3k, PDBe:7f3k, PDBj:7f3k
PDBsum7f3k
PubMed
UniProtQ9Y2T7|YBOX2_HUMAN Y-box-binding protein 2 (Gene Name=YBX2)

[Back to BioLiP]