Structure of PDB 7f3i Chain A Binding Site BS01

Receptor Information
>7f3i Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADKPVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKF
LRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f3i Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P212121
Resolution2.25 Å
Binding residue
(original residue number in PDB)		K99 W100 N102 V103 R104 N105 Y107 F109 D118 F120 H122 K153 G154 Y173
Binding residue
(residue number reindexed from 1)		K15 W16 N18 V19 R20 N21 Y23 F25 D34 F36 H38 K69 G70 Y89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7f3i, PDBe:7f3i, PDBj:7f3i
PDBsum7f3i
PubMed
UniProtQ9Y2T7|YBOX2_HUMAN Y-box-binding protein 2 (Gene Name=YBX2)

[Back to BioLiP]