Structure of PDB 7f2d Chain A Binding Site BS01

Receptor Information
>7f2d Chain A (length=143) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKNNLKVTSPDSIKGIYECAIGNFGGTLVGTVVYPKSNQKACKSYSDFDI
SFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITM
DTPEEDDYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f2d Structural insights into how vacuolar sorting receptors recognize the sorting determinants of seed storage proteins.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
R95 Y99 F100 I126 T127 M128 D129
Binding residue
(residue number reindexed from 1)
R67 Y71 F72 I98 T99 M100 D101
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7f2d, PDBe:7f2d, PDBj:7f2d
PDBsum7f2d
PubMed34983843
UniProtP93026|VSR1_ARATH Vacuolar-sorting receptor 1 (Gene Name=VSR1)

[Back to BioLiP]